Placeholder image of a protein
Icon representing a puzzle

1677: Revisiting Puzzle 137: Rosetta Decoy

Closed since almost 7 years ago

Novice Overall Prediction

Summary

Created
May 22, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a throwback puzzle to the early days of Foldit. This protein helps to regulate the human immune response, and the starting structure is a Rosetta model. The protein is modeled here in the reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


YEEVSVSGFEEFHRAVEQHNGKTIFAYFTGSKDAGGKSWCPDCVQAEPVVREGLKHISEGCVFIYCQVGEKPYWKDPNNDFRKNLKVTAVPTLLKYGTPQKLVESECLQANLVEMLFSE

Top groups

  1. Avatar for HMT heritage 11. HMT heritage 1 pt. 11,156
  2. Avatar for DW 2020 12. DW 2020 1 pt. 10,940
  3. Avatar for FoldIt@Netherlands 13. FoldIt@Netherlands 1 pt. 10,938
  4. Avatar for freefolder 14. freefolder 1 pt. 10,677
  5. Avatar for Extraterrestrials 2.0 15. Extraterrestrials 2.0 1 pt. 10,615
  6. Avatar for Eὕρηκα! Heureka! 16. Eὕρηκα! Heureka! 1 pt. 10,224
  7. Avatar for CH4110 Fold it! 17. CH4110 Fold it! 1 pt. 9,529
  1. Avatar for vizhu2018 81. vizhu2018 Lv 1 2 pts. 10,864
  2. Avatar for lconor 82. lconor Lv 1 2 pts. 10,852
  3. Avatar for rezaefar 83. rezaefar Lv 1 1 pt. 10,840
  4. Avatar for rabamino12358 84. rabamino12358 Lv 1 1 pt. 10,838
  5. Avatar for ti_go_Mars 85. ti_go_Mars Lv 1 1 pt. 10,832
  6. Avatar for Hellcat6 86. Hellcat6 Lv 1 1 pt. 10,759
  7. Avatar for JasperD 87. JasperD Lv 1 1 pt. 10,709
  8. Avatar for Altercomp 88. Altercomp Lv 1 1 pt. 10,677
  9. Avatar for Vmou 89. Vmou Lv 1 1 pt. 10,650
  10. Avatar for zanbato 90. zanbato Lv 1 1 pt. 10,615

Comments