Placeholder image of a protein
Icon representing a puzzle

1677: Revisiting Puzzle 137: Rosetta Decoy

Closed since almost 7 years ago

Novice Overall Prediction

Summary

Created
May 22, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a throwback puzzle to the early days of Foldit. This protein helps to regulate the human immune response, and the starting structure is a Rosetta model. The protein is modeled here in the reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


YEEVSVSGFEEFHRAVEQHNGKTIFAYFTGSKDAGGKSWCPDCVQAEPVVREGLKHISEGCVFIYCQVGEKPYWKDPNNDFRKNLKVTAVPTLLKYGTPQKLVESECLQANLVEMLFSE

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 11,905
  2. Avatar for Contenders 2. Contenders 73 pts. 11,686
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 52 pts. 11,671
  4. Avatar for Go Science 4. Go Science 36 pts. 11,577
  5. Avatar for Gargleblasters 5. Gargleblasters 24 pts. 11,563
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 16 pts. 11,508
  7. Avatar for Marvin's bunch 7. Marvin's bunch 10 pts. 11,471
  8. Avatar for Hold My Beer 8. Hold My Beer 6 pts. 11,430
  9. Avatar for Void Crushers 9. Void Crushers 4 pts. 11,420
  10. Avatar for Russian team 10. Russian team 2 pts. 11,355
  1. Avatar for jobo0502 11. jobo0502 Lv 1 69 pts. 11,508
  2. Avatar for retiredmichael 12. retiredmichael Lv 1 66 pts. 11,500
  3. Avatar for smilingone 13. smilingone Lv 1 64 pts. 11,484
  4. Avatar for robgee 14. robgee Lv 1 61 pts. 11,473
  5. Avatar for fpc 15. fpc Lv 1 59 pts. 11,471
  6. Avatar for Blipperman 16. Blipperman Lv 1 56 pts. 11,455
  7. Avatar for georg137 17. georg137 Lv 1 54 pts. 11,454
  8. Avatar for phi16 18. phi16 Lv 1 52 pts. 11,453
  9. Avatar for MicElephant 19. MicElephant Lv 1 50 pts. 11,443
  10. Avatar for frood66 20. frood66 Lv 1 48 pts. 11,437

Comments