Placeholder image of a protein
Icon representing a puzzle

1682: Revisiting Puzzle 52: Bacterial Energy

Closed since almost 7 years ago

Novice Overall Prediction

Summary

Created
June 04, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is part of a metabolic pathway used by bacteria to harvest energy from sugars. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


KKHIYLFSSAGMSTSLLVSKMRAQAEKYEVPVIIEAFPETLAGEKGQNADVVLLGPQIAYMLPEIQRLLPNKPVEVIDSLLYGKVDGLGVLKAAVAAIKKAAA

Top groups

  1. Avatar for Hold My Beer 11. Hold My Beer 1 pt. 11,116
  2. Avatar for Extraterrestrials 2.0 12. Extraterrestrials 2.0 1 pt. 10,271
  3. Avatar for SETI.Germany 13. SETI.Germany 1 pt. 9,914
  4. Avatar for Italiani Al Lavoro 14. Italiani Al Lavoro 1 pt. 9,874
  5. Avatar for ABG_UNIVR 15. ABG_UNIVR 1 pt. 0
  1. Avatar for Bruno Kestemont
    1. Bruno Kestemont Lv 1
    100 pts. 11,528
  2. Avatar for toshiue 2. toshiue Lv 1 78 pts. 11,528
  3. Avatar for LociOiling 3. LociOiling Lv 1 60 pts. 11,515
  4. Avatar for silent gene 4. silent gene Lv 1 45 pts. 11,501
  5. Avatar for Galaxie 5. Galaxie Lv 1 33 pts. 11,490
  6. Avatar for Deleted player 6. Deleted player pts. 11,465
  7. Avatar for lamoille 7. lamoille Lv 1 17 pts. 11,444
  8. Avatar for fpc 8. fpc Lv 1 12 pts. 11,437
  9. Avatar for robgee 9. robgee Lv 1 8 pts. 11,426
  10. Avatar for alwen 10. alwen Lv 1 6 pts. 11,415

Comments