Placeholder image of a protein
Icon representing a puzzle

1682: Revisiting Puzzle 52: Bacterial Energy

Closed since almost 7 years ago

Novice Overall Prediction

Summary

Created
June 04, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is part of a metabolic pathway used by bacteria to harvest energy from sugars. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


KKHIYLFSSAGMSTSLLVSKMRAQAEKYEVPVIIEAFPETLAGEKGQNADVVLLGPQIAYMLPEIQRLLPNKPVEVIDSLLYGKVDGLGVLKAAVAAIKKAAA

Top groups

  1. Avatar for Hold My Beer 11. Hold My Beer 1 pt. 11,116
  2. Avatar for Extraterrestrials 2.0 12. Extraterrestrials 2.0 1 pt. 10,271
  3. Avatar for SETI.Germany 13. SETI.Germany 1 pt. 9,914
  4. Avatar for Italiani Al Lavoro 14. Italiani Al Lavoro 1 pt. 9,874
  5. Avatar for ABG_UNIVR 15. ABG_UNIVR 1 pt. 0
  1. Avatar for Nordic_Alf 111. Nordic_Alf Lv 1 1 pt. 9,914
  2. Avatar for tjonesster 112. tjonesster Lv 1 1 pt. 9,913
  3. Avatar for moyi 113. moyi Lv 1 1 pt. 9,891
  4. Avatar for Ciccillo 114. Ciccillo Lv 1 1 pt. 9,874
  5. Avatar for navn 115. navn Lv 1 1 pt. 9,872
  6. Avatar for ccnu_2016213642 116. ccnu_2016213642 Lv 1 1 pt. 9,869
  7. Avatar for kludbrook 117. kludbrook Lv 1 1 pt. 9,862
  8. Avatar for FenixP 118. FenixP Lv 1 1 pt. 9,814
  9. Avatar for borattt 119. borattt Lv 1 1 pt. 9,803
  10. Avatar for swang28 120. swang28 Lv 1 1 pt. 9,791

Comments