Placeholder image of a protein
Icon representing a puzzle

1682: Revisiting Puzzle 52: Bacterial Energy

Closed since almost 7 years ago

Novice Novice Overall Overall Prediction Prediction

Summary


Created
June 04, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is part of a metabolic pathway used by bacteria to harvest energy from sugars. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


KKHIYLFSSAGMSTSLLVSKMRAQAEKYEVPVIIEAFPETLAGEKGQNADVVLLGPQIAYMLPEIQRLLPNKPVEVIDSLLYGKVDGLGVLKAAVAAIKKAAA

Top groups


  1. Avatar for Hold My Beer 11. Hold My Beer 1 pt. 11,116
  2. Avatar for Extraterrestrials 2.0 12. Extraterrestrials 2.0 1 pt. 10,271
  3. Avatar for SETI.Germany 13. SETI.Germany 1 pt. 9,914
  4. Avatar for Italiani Al Lavoro 14. Italiani Al Lavoro 1 pt. 9,874
  5. Avatar for ABG_UNIVR 15. ABG_UNIVR 1 pt. 0

  1. Avatar for jamiexq 121. jamiexq Lv 1 1 pt. 9,756
  2. Avatar for xunzhu 122. xunzhu Lv 1 1 pt. 9,755
  3. Avatar for Csisz00 123. Csisz00 Lv 1 1 pt. 9,714
  4. Avatar for MikiSuzaki 124. MikiSuzaki Lv 1 1 pt. 9,713
  5. Avatar for lcquxb 125. lcquxb Lv 1 1 pt. 9,697
  6. Avatar for Knoblerine 126. Knoblerine Lv 1 1 pt. 9,686
  7. Avatar for kkajdi 127. kkajdi Lv 1 1 pt. 9,611
  8. Avatar for Fowardint 128. Fowardint Lv 1 1 pt. 9,609
  9. Avatar for DipsyDoodle2016 129. DipsyDoodle2016 Lv 1 1 pt. 9,602
  10. Avatar for jimive 130. jimive Lv 1 1 pt. 9,549

Comments