Placeholder image of a protein
Icon representing a puzzle

1682: Revisiting Puzzle 52: Bacterial Energy

Closed since almost 7 years ago

Novice Overall Prediction

Summary

Created
June 04, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is part of a metabolic pathway used by bacteria to harvest energy from sugars. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


KKHIYLFSSAGMSTSLLVSKMRAQAEKYEVPVIIEAFPETLAGEKGQNADVVLLGPQIAYMLPEIQRLLPNKPVEVIDSLLYGKVDGLGVLKAAVAAIKKAAA

Top groups

  1. Avatar for Hold My Beer 11. Hold My Beer 1 pt. 11,116
  2. Avatar for Extraterrestrials 2.0 12. Extraterrestrials 2.0 1 pt. 10,271
  3. Avatar for SETI.Germany 13. SETI.Germany 1 pt. 9,914
  4. Avatar for Italiani Al Lavoro 14. Italiani Al Lavoro 1 pt. 9,874
  5. Avatar for ABG_UNIVR 15. ABG_UNIVR 1 pt. 0
  1. Avatar for Dimoniu 131. Dimoniu Lv 1 1 pt. 9,458
  2. Avatar for MicheleVerret 132. MicheleVerret Lv 1 1 pt. 9,453
  3. Avatar for Marvelz 133. Marvelz Lv 1 1 pt. 9,330
  4. Avatar for Squirrely 134. Squirrely Lv 1 1 pt. 9,326
  5. Avatar for frostschutz 135. frostschutz Lv 1 1 pt. 9,182
  6. Avatar for mberna00 136. mberna00 Lv 1 1 pt. 9,067
  7. Avatar for pix999 137. pix999 Lv 1 1 pt. 8,928
  8. Avatar for 01010011111 138. 01010011111 Lv 1 1 pt. 8,906
  9. Avatar for Anime is my life 139. Anime is my life Lv 1 1 pt. 8,903
  10. Avatar for orily1337 140. orily1337 Lv 1 1 pt. 8,644

Comments