Placeholder image of a protein
Icon representing a puzzle

1682: Revisiting Puzzle 52: Bacterial Energy

Closed since almost 7 years ago

Novice Overall Prediction

Summary

Created
June 04, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is part of a metabolic pathway used by bacteria to harvest energy from sugars. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


KKHIYLFSSAGMSTSLLVSKMRAQAEKYEVPVIIEAFPETLAGEKGQNADVVLLGPQIAYMLPEIQRLLPNKPVEVIDSLLYGKVDGLGVLKAAVAAIKKAAA

Top groups

  1. Avatar for Hold My Beer 11. Hold My Beer 1 pt. 11,116
  2. Avatar for Extraterrestrials 2.0 12. Extraterrestrials 2.0 1 pt. 10,271
  3. Avatar for SETI.Germany 13. SETI.Germany 1 pt. 9,914
  4. Avatar for Italiani Al Lavoro 14. Italiani Al Lavoro 1 pt. 9,874
  5. Avatar for ABG_UNIVR 15. ABG_UNIVR 1 pt. 0
  1. Avatar for christioanchauvin 31. christioanchauvin Lv 1 34 pts. 10,951
  2. Avatar for dcrwheeler 32. dcrwheeler Lv 1 33 pts. 10,933
  3. Avatar for Deleted player 33. Deleted player pts. 10,904
  4. Avatar for Threeoak 34. Threeoak Lv 1 30 pts. 10,893
  5. Avatar for alcor29 35. alcor29 Lv 1 29 pts. 10,890
  6. Avatar for Hellcat6 36. Hellcat6 Lv 1 28 pts. 10,889
  7. Avatar for jausmh 37. jausmh Lv 1 27 pts. 10,886
  8. Avatar for fpc 38. fpc Lv 1 26 pts. 10,881
  9. Avatar for Skippysk8s 39. Skippysk8s Lv 1 24 pts. 10,878
  10. Avatar for jtrube1 40. jtrube1 Lv 1 23 pts. 10,849

Comments