Placeholder image of a protein
Icon representing a puzzle

1682: Revisiting Puzzle 52: Bacterial Energy

Closed since almost 7 years ago

Novice Overall Prediction

Summary

Created
June 04, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is part of a metabolic pathway used by bacteria to harvest energy from sugars. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


KKHIYLFSSAGMSTSLLVSKMRAQAEKYEVPVIIEAFPETLAGEKGQNADVVLLGPQIAYMLPEIQRLLPNKPVEVIDSLLYGKVDGLGVLKAAVAAIKKAAA

Top groups

  1. Avatar for Hold My Beer 11. Hold My Beer 1 pt. 11,116
  2. Avatar for Extraterrestrials 2.0 12. Extraterrestrials 2.0 1 pt. 10,271
  3. Avatar for SETI.Germany 13. SETI.Germany 1 pt. 9,914
  4. Avatar for Italiani Al Lavoro 14. Italiani Al Lavoro 1 pt. 9,874
  5. Avatar for ABG_UNIVR 15. ABG_UNIVR 1 pt. 0
  1. Avatar for diamonddays 51. diamonddays Lv 1 14 pts. 10,756
  2. Avatar for Idiotboy 52. Idiotboy Lv 1 14 pts. 10,749
  3. Avatar for tarimo 53. tarimo Lv 1 13 pts. 10,734
  4. Avatar for nlachance 54. nlachance Lv 1 12 pts. 10,732
  5. Avatar for WBarme1234 55. WBarme1234 Lv 1 12 pts. 10,695
  6. Avatar for Norrjane 56. Norrjane Lv 1 11 pts. 10,683
  7. Avatar for martin.kendig@verizon.net 57. martin.kendig@verizon.net Lv 1 11 pts. 10,674
  8. Avatar for joremen 58. joremen Lv 1 10 pts. 10,672
  9. Avatar for benrh 59. benrh Lv 1 10 pts. 10,660
  10. Avatar for ManVsYard 60. ManVsYard Lv 1 9 pts. 10,649

Comments