Placeholder image of a protein
Icon representing a puzzle

1682: Revisiting Puzzle 52: Bacterial Energy

Closed since almost 7 years ago

Novice Overall Prediction

Summary

Created
June 04, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is part of a metabolic pathway used by bacteria to harvest energy from sugars. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


KKHIYLFSSAGMSTSLLVSKMRAQAEKYEVPVIIEAFPETLAGEKGQNADVVLLGPQIAYMLPEIQRLLPNKPVEVIDSLLYGKVDGLGVLKAAVAAIKKAAA

Top groups

  1. Avatar for Hold My Beer 11. Hold My Beer 1 pt. 11,116
  2. Avatar for Extraterrestrials 2.0 12. Extraterrestrials 2.0 1 pt. 10,271
  3. Avatar for SETI.Germany 13. SETI.Germany 1 pt. 9,914
  4. Avatar for Italiani Al Lavoro 14. Italiani Al Lavoro 1 pt. 9,874
  5. Avatar for ABG_UNIVR 15. ABG_UNIVR 1 pt. 0
  1. Avatar for abiogenesis 61. abiogenesis Lv 1 9 pts. 10,641
  2. Avatar for Merf 62. Merf Lv 1 8 pts. 10,641
  3. Avatar for andrewxc 63. andrewxc Lv 1 8 pts. 10,591
  4. Avatar for rezaefar 64. rezaefar Lv 1 8 pts. 10,573
  5. Avatar for tela 65. tela Lv 1 7 pts. 10,562
  6. Avatar for toshiue 66. toshiue Lv 1 7 pts. 10,524
  7. Avatar for alwen 67. alwen Lv 1 6 pts. 10,521
  8. Avatar for fearjuan 68. fearjuan Lv 1 6 pts. 10,511
  9. Avatar for 181818 69. 181818 Lv 1 6 pts. 10,507
  10. Avatar for joaniegirl 70. joaniegirl Lv 1 5 pts. 10,472

Comments