Placeholder image of a protein
Icon representing a puzzle

1682: Revisiting Puzzle 52: Bacterial Energy

Closed since almost 7 years ago

Novice Overall Prediction

Summary

Created
June 04, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is part of a metabolic pathway used by bacteria to harvest energy from sugars. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


KKHIYLFSSAGMSTSLLVSKMRAQAEKYEVPVIIEAFPETLAGEKGQNADVVLLGPQIAYMLPEIQRLLPNKPVEVIDSLLYGKVDGLGVLKAAVAAIKKAAA

Top groups

  1. Avatar for Hold My Beer 11. Hold My Beer 1 pt. 11,116
  2. Avatar for Extraterrestrials 2.0 12. Extraterrestrials 2.0 1 pt. 10,271
  3. Avatar for SETI.Germany 13. SETI.Germany 1 pt. 9,914
  4. Avatar for Italiani Al Lavoro 14. Italiani Al Lavoro 1 pt. 9,874
  5. Avatar for ABG_UNIVR 15. ABG_UNIVR 1 pt. 0
  1. Avatar for Biochemica 81. Biochemica Lv 1 3 pts. 10,338
  2. Avatar for Altercomp 82. Altercomp Lv 1 3 pts. 10,336
  3. Avatar for Mike Cassidy 83. Mike Cassidy Lv 1 3 pts. 10,324
  4. Avatar for pfirth 84. pfirth Lv 1 3 pts. 10,320
  5. Avatar for rinze 85. rinze Lv 1 2 pts. 10,308
  6. Avatar for felixxy 86. felixxy Lv 1 2 pts. 10,304
  7. Avatar for harvardman 87. harvardman Lv 1 2 pts. 10,284
  8. Avatar for kentish_alex 88. kentish_alex Lv 1 2 pts. 10,275
  9. Avatar for zanbato 89. zanbato Lv 1 2 pts. 10,271
  10. Avatar for Arne Heessels 90. Arne Heessels Lv 1 2 pts. 10,265

Comments