Placeholder image of a protein
Icon representing a puzzle

1682: Revisiting Puzzle 52: Bacterial Energy

Closed since almost 7 years ago

Novice Overall Prediction

Summary

Created
June 04, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is part of a metabolic pathway used by bacteria to harvest energy from sugars. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


KKHIYLFSSAGMSTSLLVSKMRAQAEKYEVPVIIEAFPETLAGEKGQNADVVLLGPQIAYMLPEIQRLLPNKPVEVIDSLLYGKVDGLGVLKAAVAAIKKAAA

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 11,528
  2. Avatar for Beta Folders 2. Beta Folders 70 pts. 11,515
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 47 pts. 11,490
  4. Avatar for Marvin's bunch 4. Marvin's bunch 30 pts. 11,437
  5. Avatar for HMT heritage 5. HMT heritage 19 pts. 11,417
  6. Avatar for Void Crushers 6. Void Crushers 11 pts. 11,411
  7. Avatar for Russian team 7. Russian team 7 pts. 11,311
  8. Avatar for Contenders 8. Contenders 4 pts. 11,264
  9. Avatar for L'Alliance Francophone 9. L'Alliance Francophone 2 pts. 11,254
  10. Avatar for Gargleblasters 10. Gargleblasters 1 pt. 11,244
  1. Avatar for christioanchauvin 31. christioanchauvin Lv 1 34 pts. 10,951
  2. Avatar for dcrwheeler 32. dcrwheeler Lv 1 33 pts. 10,933
  3. Avatar for Deleted player 33. Deleted player pts. 10,904
  4. Avatar for Threeoak 34. Threeoak Lv 1 30 pts. 10,893
  5. Avatar for alcor29 35. alcor29 Lv 1 29 pts. 10,890
  6. Avatar for Hellcat6 36. Hellcat6 Lv 1 28 pts. 10,889
  7. Avatar for jausmh 37. jausmh Lv 1 27 pts. 10,886
  8. Avatar for fpc 38. fpc Lv 1 26 pts. 10,881
  9. Avatar for Skippysk8s 39. Skippysk8s Lv 1 24 pts. 10,878
  10. Avatar for jtrube1 40. jtrube1 Lv 1 23 pts. 10,849

Comments