Placeholder image of a protein
Icon representing a puzzle

1682: Revisiting Puzzle 52: Bacterial Energy

Closed since almost 7 years ago

Novice Overall Prediction

Summary


Created
June 04, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is part of a metabolic pathway used by bacteria to harvest energy from sugars. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


KKHIYLFSSAGMSTSLLVSKMRAQAEKYEVPVIIEAFPETLAGEKGQNADVVLLGPQIAYMLPEIQRLLPNKPVEVIDSLLYGKVDGLGVLKAAVAAIKKAAA

Top groups


  1. Avatar for Go Science 100 pts. 11,528
  2. Avatar for Beta Folders 2. Beta Folders 70 pts. 11,515
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 47 pts. 11,490
  4. Avatar for Marvin's bunch 4. Marvin's bunch 30 pts. 11,437
  5. Avatar for HMT heritage 5. HMT heritage 19 pts. 11,417
  6. Avatar for Void Crushers 6. Void Crushers 11 pts. 11,411
  7. Avatar for Russian team 7. Russian team 7 pts. 11,311
  8. Avatar for Contenders 8. Contenders 4 pts. 11,264
  9. Avatar for L'Alliance Francophone 9. L'Alliance Francophone 2 pts. 11,254
  10. Avatar for Gargleblasters 10. Gargleblasters 1 pt. 11,244

  1. Avatar for TastyMunchies 41. TastyMunchies Lv 1 22 pts. 10,833
  2. Avatar for georg137 42. georg137 Lv 1 22 pts. 10,833
  3. Avatar for Blipperman 43. Blipperman Lv 1 21 pts. 10,824
  4. Avatar for Aminal88 44. Aminal88 Lv 1 20 pts. 10,820
  5. Avatar for YeshuaLives 45. YeshuaLives Lv 1 19 pts. 10,790
  6. Avatar for Artoria2e5 46. Artoria2e5 Lv 1 18 pts. 10,790
  7. Avatar for Vinara 47. Vinara Lv 1 17 pts. 10,787
  8. Avatar for PlagueRat 48. PlagueRat Lv 1 16 pts. 10,769
  9. Avatar for Pawel Tluscik 49. Pawel Tluscik Lv 1 16 pts. 10,767
  10. Avatar for aznarog 50. aznarog Lv 1 15 pts. 10,759

Comments