Placeholder image of a protein
Icon representing a puzzle

1690: Revisiting Puzzle 57: Beta-Neurotoxin

Closed since over 6 years ago

Intermediate Overall Prediction

Summary

Created
June 24, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This scorpion toxin is similar to the one from Puzzle 55, and binds to voltage-gated ion channels of insects. The protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


KDGYLVEKTGCKKTCYKLGENDFCNRECKWKHIGGSYGYCYGFGCYCEGLPDSTQTWPLPNKTC

Top groups

  1. Avatar for BOINC@Poland 11. BOINC@Poland 1 pt. 9,527
  2. Avatar for Hold My Beer 12. Hold My Beer 1 pt. 9,008
  3. Avatar for DSN @ Home 13. DSN @ Home 1 pt. 8,911
  4. Avatar for Trinity Biology 14. Trinity Biology 1 pt. 8,777
  1. Avatar for LociOiling
    1. LociOiling Lv 1
    100 pts. 10,550
  2. Avatar for retiredmichael 2. retiredmichael Lv 1 81 pts. 10,543
  3. Avatar for Galaxie 3. Galaxie Lv 1 64 pts. 10,508
  4. Avatar for actiasluna 4. actiasluna Lv 1 50 pts. 10,505
  5. Avatar for Blipperman 5. Blipperman Lv 1 39 pts. 10,505
  6. Avatar for Keresto 6. Keresto Lv 1 30 pts. 10,503
  7. Avatar for fpc 7. fpc Lv 1 23 pts. 10,501
  8. Avatar for ManVsYard 8. ManVsYard Lv 1 17 pts. 10,497
  9. Avatar for Skippysk8s 9. Skippysk8s Lv 1 12 pts. 10,495
  10. Avatar for robgee 10. robgee Lv 1 9 pts. 10,494

Comments