Placeholder image of a protein
Icon representing a puzzle

1690: Revisiting Puzzle 57: Beta-Neurotoxin

Closed since almost 7 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary


Created
June 24, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This scorpion toxin is similar to the one from Puzzle 55, and binds to voltage-gated ion channels of insects. The protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


KDGYLVEKTGCKKTCYKLGENDFCNRECKWKHIGGSYGYCYGFGCYCEGLPDSTQTWPLPNKTC

Top groups


  1. Avatar for BOINC@Poland 11. BOINC@Poland 1 pt. 9,527
  2. Avatar for Hold My Beer 12. Hold My Beer 1 pt. 9,008
  3. Avatar for DSN @ Home 13. DSN @ Home 1 pt. 8,911
  4. Avatar for Trinity Biology 14. Trinity Biology 1 pt. 8,777

  1. Avatar for LociOiling
    1. LociOiling Lv 1
    100 pts. 10,555
  2. Avatar for tyler0911 2. tyler0911 Lv 1 97 pts. 10,500
  3. Avatar for actiasluna 3. actiasluna Lv 1 93 pts. 10,498
  4. Avatar for frood66 4. frood66 Lv 1 90 pts. 10,471
  5. Avatar for fiendish_ghoul 5. fiendish_ghoul Lv 1 86 pts. 10,444
  6. Avatar for retiredmichael 6. retiredmichael Lv 1 83 pts. 10,443
  7. Avatar for silent gene 7. silent gene Lv 1 80 pts. 10,434
  8. Avatar for nicobul 8. nicobul Lv 1 76 pts. 10,411
  9. Avatar for grogar7 9. grogar7 Lv 1 73 pts. 10,394
  10. Avatar for Bruno Kestemont 10. Bruno Kestemont Lv 1 71 pts. 10,374

Comments