Placeholder image of a protein
Icon representing a puzzle

1690: Revisiting Puzzle 57: Beta-Neurotoxin

Closed since almost 7 years ago

Intermediate Overall Prediction

Summary

Created
June 24, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This scorpion toxin is similar to the one from Puzzle 55, and binds to voltage-gated ion channels of insects. The protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


KDGYLVEKTGCKKTCYKLGENDFCNRECKWKHIGGSYGYCYGFGCYCEGLPDSTQTWPLPNKTC

Top groups

  1. Avatar for BOINC@Poland 11. BOINC@Poland 1 pt. 9,527
  2. Avatar for Hold My Beer 12. Hold My Beer 1 pt. 9,008
  3. Avatar for DSN @ Home 13. DSN @ Home 1 pt. 8,911
  4. Avatar for Trinity Biology 14. Trinity Biology 1 pt. 8,777
  1. Avatar for rinze 91. rinze Lv 1 1 pt. 8,532
  2. Avatar for hajtogato 92. hajtogato Lv 1 1 pt. 8,499
  3. Avatar for harvardman 93. harvardman Lv 1 1 pt. 8,471
  4. Avatar for justjustin 94. justjustin Lv 1 1 pt. 8,466
  5. Avatar for Forschender Doktorand 95. Forschender Doktorand Lv 1 1 pt. 8,430
  6. Avatar for Noosfera 96. Noosfera Lv 1 1 pt. 8,365
  7. Avatar for rol 97. rol Lv 1 1 pt. 8,359
  8. Avatar for Squirrely 98. Squirrely Lv 1 1 pt. 8,350
  9. Avatar for martinf 99. martinf Lv 1 1 pt. 8,325
  10. Avatar for ScyllaHide 100. ScyllaHide Lv 1 1 pt. 8,291

Comments