Placeholder image of a protein
Icon representing a puzzle

1690: Revisiting Puzzle 57: Beta-Neurotoxin

Closed since almost 7 years ago

Intermediate Overall Prediction

Summary

Created
June 24, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This scorpion toxin is similar to the one from Puzzle 55, and binds to voltage-gated ion channels of insects. The protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


KDGYLVEKTGCKKTCYKLGENDFCNRECKWKHIGGSYGYCYGFGCYCEGLPDSTQTWPLPNKTC

Top groups

  1. Avatar for BOINC@Poland 11. BOINC@Poland 1 pt. 9,527
  2. Avatar for Hold My Beer 12. Hold My Beer 1 pt. 9,008
  3. Avatar for DSN @ Home 13. DSN @ Home 1 pt. 8,911
  4. Avatar for Trinity Biology 14. Trinity Biology 1 pt. 8,777
  1. Avatar for nagyzs 101. nagyzs Lv 1 1 pt. 8,274
  2. Avatar for Anamfija 102. Anamfija Lv 1 1 pt. 8,240
  3. Avatar for 15SecNut 103. 15SecNut Lv 1 1 pt. 8,216
  4. Avatar for xbp 104. xbp Lv 1 1 pt. 8,215
  5. Avatar for multaq 105. multaq Lv 1 1 pt. 8,212
  6. Avatar for MTaye 106. MTaye Lv 1 1 pt. 8,153
  7. Avatar for kludbrook 107. kludbrook Lv 1 1 pt. 8,149
  8. Avatar for Dantoto 108. Dantoto Lv 1 1 pt. 8,140
  9. Avatar for Benny_ZX 109. Benny_ZX Lv 1 1 pt. 8,129
  10. Avatar for COMPUTER11 110. COMPUTER11 Lv 1 1 pt. 8,124

Comments