Placeholder image of a protein
Icon representing a puzzle

1690: Revisiting Puzzle 57: Beta-Neurotoxin

Closed since almost 7 years ago

Intermediate Overall Prediction

Summary

Created
June 24, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This scorpion toxin is similar to the one from Puzzle 55, and binds to voltage-gated ion channels of insects. The protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


KDGYLVEKTGCKKTCYKLGENDFCNRECKWKHIGGSYGYCYGFGCYCEGLPDSTQTWPLPNKTC

Top groups

  1. Avatar for BOINC@Poland 11. BOINC@Poland 1 pt. 9,527
  2. Avatar for Hold My Beer 12. Hold My Beer 1 pt. 9,008
  3. Avatar for DSN @ Home 13. DSN @ Home 1 pt. 8,911
  4. Avatar for Trinity Biology 14. Trinity Biology 1 pt. 8,777
  1. Avatar for manu8170 121. manu8170 Lv 1 1 pt. 7,015
  2. Avatar for 01010011111 122. 01010011111 Lv 1 1 pt. 5,687
  3. Avatar for jbmkfm125 123. jbmkfm125 Lv 1 1 pt. 3,798
  4. Avatar for bkoep 124. bkoep Lv 1 1 pt. 0
  5. Avatar for Hollinas 125. Hollinas Lv 1 1 pt. 0
  6. Avatar for Tehnologik1 126. Tehnologik1 Lv 1 1 pt. 0
  7. Avatar for ludov 127. ludov Lv 1 1 pt. 0
  8. Avatar for lamoille 128. lamoille Lv 1 1 pt. 0
  9. Avatar for dettingen 129. dettingen Lv 1 1 pt. 0
  10. Avatar for gurch 130. gurch Lv 1 1 pt. 0

Comments