Placeholder image of a protein
Icon representing a puzzle

1690: Revisiting Puzzle 57: Beta-Neurotoxin

Closed since almost 7 years ago

Intermediate Overall Prediction

Summary

Created
June 24, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This scorpion toxin is similar to the one from Puzzle 55, and binds to voltage-gated ion channels of insects. The protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


KDGYLVEKTGCKKTCYKLGENDFCNRECKWKHIGGSYGYCYGFGCYCEGLPDSTQTWPLPNKTC

Top groups

  1. Avatar for BOINC@Poland 11. BOINC@Poland 1 pt. 9,527
  2. Avatar for Hold My Beer 12. Hold My Beer 1 pt. 9,008
  3. Avatar for DSN @ Home 13. DSN @ Home 1 pt. 8,911
  4. Avatar for Trinity Biology 14. Trinity Biology 1 pt. 8,777
  1. Avatar for heather-1 51. heather-1 Lv 1 10 pts. 9,834
  2. Avatar for alcor29 52. alcor29 Lv 1 9 pts. 9,814
  3. Avatar for Keresto 53. Keresto Lv 1 8 pts. 9,764
  4. Avatar for ReallyRatherDumb 54. ReallyRatherDumb Lv 1 8 pts. 9,711
  5. Avatar for kentish_alex 55. kentish_alex Lv 1 8 pts. 9,594
  6. Avatar for dbuske 56. dbuske Lv 1 7 pts. 9,558
  7. Avatar for kitek314_pl 57. kitek314_pl Lv 1 7 pts. 9,527
  8. Avatar for Artoria2e5 58. Artoria2e5 Lv 1 6 pts. 9,516
  9. Avatar for martin.kendig@verizon.net 59. martin.kendig@verizon.net Lv 1 6 pts. 9,500
  10. Avatar for cbwest 60. cbwest Lv 1 6 pts. 9,422

Comments