Placeholder image of a protein
Icon representing a puzzle

1690: Revisiting Puzzle 57: Beta-Neurotoxin

Closed since almost 7 years ago

Intermediate Overall Prediction

Summary

Created
June 24, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This scorpion toxin is similar to the one from Puzzle 55, and binds to voltage-gated ion channels of insects. The protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


KDGYLVEKTGCKKTCYKLGENDFCNRECKWKHIGGSYGYCYGFGCYCEGLPDSTQTWPLPNKTC

Top groups

  1. Avatar for BOINC@Poland 11. BOINC@Poland 1 pt. 9,527
  2. Avatar for Hold My Beer 12. Hold My Beer 1 pt. 9,008
  3. Avatar for DSN @ Home 13. DSN @ Home 1 pt. 8,911
  4. Avatar for Trinity Biology 14. Trinity Biology 1 pt. 8,777
  1. Avatar for Steven Pletsch 71. Steven Pletsch Lv 1 3 pts. 9,008
  2. Avatar for Aminal88 72. Aminal88 Lv 1 3 pts. 8,939
  3. Avatar for Origami314 73. Origami314 Lv 1 2 pts. 8,926
  4. Avatar for aspadistra 74. aspadistra Lv 1 2 pts. 8,911
  5. Avatar for benrh 75. benrh Lv 1 2 pts. 8,903
  6. Avatar for Altercomp 76. Altercomp Lv 1 2 pts. 8,884
  7. Avatar for mitarcher 77. mitarcher Lv 1 2 pts. 8,841
  8. Avatar for Dhalion 78. Dhalion Lv 1 2 pts. 8,838
  9. Avatar for RyeSnake 79. RyeSnake Lv 1 2 pts. 8,824
  10. Avatar for hansvandenhof 80. hansvandenhof Lv 1 1 pt. 8,807

Comments