Placeholder image of a protein
Icon representing a puzzle

1690: Revisiting Puzzle 57: Beta-Neurotoxin

Closed since almost 7 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary


Created
June 24, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This scorpion toxin is similar to the one from Puzzle 55, and binds to voltage-gated ion channels of insects. The protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


KDGYLVEKTGCKKTCYKLGENDFCNRECKWKHIGGSYGYCYGFGCYCEGLPDSTQTWPLPNKTC

Top groups


  1. Avatar for Beta Folders 100 pts. 10,555
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 68 pts. 10,508
  3. Avatar for Gargleblasters 3. Gargleblasters 44 pts. 10,505
  4. Avatar for Marvin's bunch 4. Marvin's bunch 27 pts. 10,501
  5. Avatar for Go Science 5. Go Science 16 pts. 10,444
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 9 pts. 10,411
  7. Avatar for Contenders 7. Contenders 5 pts. 10,335
  8. Avatar for Void Crushers 8. Void Crushers 3 pts. 10,239
  9. Avatar for HMT heritage 9. HMT heritage 1 pt. 10,132
  10. Avatar for Russian team 10. Russian team 1 pt. 9,994

  1. Avatar for jamiexq 111. jamiexq Lv 1 1 pt. 8,112
  2. Avatar for pey123456 112. pey123456 Lv 1 1 pt. 8,097
  3. Avatar for GoldTrio 113. GoldTrio Lv 1 1 pt. 8,034
  4. Avatar for joaniegirl 114. joaniegirl Lv 1 1 pt. 8,007
  5. Avatar for molecularAle 115. molecularAle Lv 1 1 pt. 7,984
  6. Avatar for donuts554 116. donuts554 Lv 1 1 pt. 7,907
  7. Avatar for Keisuke 117. Keisuke Lv 1 1 pt. 7,861
  8. Avatar for LesleyChou 118. LesleyChou Lv 1 1 pt. 7,783
  9. Avatar for Mosica 119. Mosica Lv 1 1 pt. 7,771
  10. Avatar for computer22 120. computer22 Lv 1 1 pt. 7,449

Comments