Placeholder image of a protein
Icon representing a puzzle

1690: Revisiting Puzzle 57: Beta-Neurotoxin

Closed since almost 7 years ago

Intermediate Overall Prediction

Summary


Created
June 24, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This scorpion toxin is similar to the one from Puzzle 55, and binds to voltage-gated ion channels of insects. The protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


KDGYLVEKTGCKKTCYKLGENDFCNRECKWKHIGGSYGYCYGFGCYCEGLPDSTQTWPLPNKTC

Top groups


  1. Avatar for Beta Folders 100 pts. 10,555
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 68 pts. 10,508
  3. Avatar for Gargleblasters 3. Gargleblasters 44 pts. 10,505
  4. Avatar for Marvin's bunch 4. Marvin's bunch 27 pts. 10,501
  5. Avatar for Go Science 5. Go Science 16 pts. 10,444
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 9 pts. 10,411
  7. Avatar for Contenders 7. Contenders 5 pts. 10,335
  8. Avatar for Void Crushers 8. Void Crushers 3 pts. 10,239
  9. Avatar for HMT heritage 9. HMT heritage 1 pt. 10,132
  10. Avatar for Russian team 10. Russian team 1 pt. 9,994

  1. Avatar for Deleted player 41. Deleted player 17 pts. 10,030
  2. Avatar for aznarog 42. aznarog Lv 1 16 pts. 10,003
  3. Avatar for vakobo 43. vakobo Lv 1 15 pts. 9,994
  4. Avatar for Museka 44. Museka Lv 1 14 pts. 9,983
  5. Avatar for fpc 45. fpc Lv 1 13 pts. 9,976
  6. Avatar for pvc78 46. pvc78 Lv 1 13 pts. 9,947
  7. Avatar for stomjoh 47. stomjoh Lv 1 12 pts. 9,899
  8. Avatar for Skippysk8s 48. Skippysk8s Lv 1 11 pts. 9,897
  9. Avatar for TastyMunchies 49. TastyMunchies Lv 1 11 pts. 9,888
  10. Avatar for WBarme1234 50. WBarme1234 Lv 1 10 pts. 9,846

Comments