Placeholder image of a protein
Icon representing a puzzle

1690: Revisiting Puzzle 57: Beta-Neurotoxin

Closed since almost 7 years ago

Intermediate Overall Prediction

Summary


Created
June 24, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This scorpion toxin is similar to the one from Puzzle 55, and binds to voltage-gated ion channels of insects. The protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


KDGYLVEKTGCKKTCYKLGENDFCNRECKWKHIGGSYGYCYGFGCYCEGLPDSTQTWPLPNKTC

Top groups


  1. Avatar for Beta Folders 100 pts. 10,555
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 68 pts. 10,508
  3. Avatar for Gargleblasters 3. Gargleblasters 44 pts. 10,505
  4. Avatar for Marvin's bunch 4. Marvin's bunch 27 pts. 10,501
  5. Avatar for Go Science 5. Go Science 16 pts. 10,444
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 9 pts. 10,411
  7. Avatar for Contenders 7. Contenders 5 pts. 10,335
  8. Avatar for Void Crushers 8. Void Crushers 3 pts. 10,239
  9. Avatar for HMT heritage 9. HMT heritage 1 pt. 10,132
  10. Avatar for Russian team 10. Russian team 1 pt. 9,994

  1. Avatar for lconor 61. lconor Lv 1 5 pts. 9,364
  2. Avatar for abiogenesis 62. abiogenesis Lv 1 5 pts. 9,331
  3. Avatar for Merf 63. Merf Lv 1 5 pts. 9,305
  4. Avatar for drumpeter18yrs9yrs 64. drumpeter18yrs9yrs Lv 1 4 pts. 9,268
  5. Avatar for PeterDav 65. PeterDav Lv 1 4 pts. 9,157
  6. Avatar for ManVsYard 66. ManVsYard Lv 1 4 pts. 9,126
  7. Avatar for cobaltteal 67. cobaltteal Lv 1 4 pts. 9,120
  8. Avatar for ourtown 68. ourtown Lv 1 3 pts. 9,090
  9. Avatar for frostschutz 69. frostschutz Lv 1 3 pts. 9,065
  10. Avatar for iveenp 70. iveenp Lv 1 3 pts. 9,049

Comments