Placeholder image of a protein
Icon representing a puzzle

1690: Revisiting Puzzle 57: Beta-Neurotoxin

Closed since over 6 years ago

Intermediate Overall Prediction

Summary

Created
June 24, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This scorpion toxin is similar to the one from Puzzle 55, and binds to voltage-gated ion channels of insects. The protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


KDGYLVEKTGCKKTCYKLGENDFCNRECKWKHIGGSYGYCYGFGCYCEGLPDSTQTWPLPNKTC

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 10,555
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 68 pts. 10,508
  3. Avatar for Gargleblasters 3. Gargleblasters 44 pts. 10,505
  4. Avatar for Marvin's bunch 4. Marvin's bunch 27 pts. 10,501
  5. Avatar for Go Science 5. Go Science 16 pts. 10,444
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 9 pts. 10,411
  7. Avatar for Contenders 7. Contenders 5 pts. 10,335
  8. Avatar for Void Crushers 8. Void Crushers 3 pts. 10,239
  9. Avatar for HMT heritage 9. HMT heritage 1 pt. 10,132
  10. Avatar for Russian team 10. Russian team 1 pt. 9,994
  1. Avatar for rabamino12358 81. rabamino12358 Lv 1 1 pt. 8,785
  2. Avatar for alyssa_d 82. alyssa_d Lv 1 1 pt. 8,777
  3. Avatar for IHGreenman 83. IHGreenman Lv 1 1 pt. 8,736
  4. Avatar for Pawel Tluscik 84. Pawel Tluscik Lv 1 1 pt. 8,722
  5. Avatar for Arne Heessels 85. Arne Heessels Lv 1 1 pt. 8,714
  6. Avatar for Biochemica 86. Biochemica Lv 1 1 pt. 8,678
  7. Avatar for Willyanto 87. Willyanto Lv 1 1 pt. 8,663
  8. Avatar for Datstandin 88. Datstandin Lv 1 1 pt. 8,600
  9. Avatar for rezaefar 89. rezaefar Lv 1 1 pt. 8,579
  10. Avatar for helen88 90. helen88 Lv 1 1 pt. 8,573

Comments