Placeholder image of a protein
Icon representing a puzzle

1691: Unsolved De-novo Freestyle 154

Closed since over 6 years ago

Intermediate Overall Prediction

Summary


Created
June 25, 2019
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:

GSREELLDRLDEILDEADKIIERANEALKEKDDKSKYQKLLKEHEEAVDKLLKIAEKHREMG

Top groups


  1. Avatar for HMT heritage 11. HMT heritage 1 pt. 9,731
  2. Avatar for Team China 12. Team China 1 pt. 9,192
  3. Avatar for BOINC@Poland 13. BOINC@Poland 1 pt. 9,124
  4. Avatar for Trinity Biology 14. Trinity Biology 1 pt. 8,789
  5. Avatar for DSN @ Home 15. DSN @ Home 1 pt. 0

  1. Avatar for Galaxie
    1. Galaxie Lv 1
    100 pts. 10,021
  2. Avatar for phi16 2. phi16 Lv 1 78 pts. 10,005
  3. Avatar for robgee 3. robgee Lv 1 60 pts. 9,994
  4. Avatar for Deleted player 4. Deleted player pts. 9,994
  5. Avatar for lamoille 5. lamoille Lv 1 33 pts. 9,987
  6. Avatar for alwen 6. alwen Lv 1 24 pts. 9,986
  7. Avatar for toshiue 7. toshiue Lv 1 17 pts. 9,985
  8. Avatar for NinjaGreg 8. NinjaGreg Lv 1 12 pts. 9,982
  9. Avatar for alcor29 9. alcor29 Lv 1 8 pts. 9,977
  10. Avatar for Bruno Kestemont 10. Bruno Kestemont Lv 1 6 pts. 9,977

Comments