Placeholder image of a protein
Icon representing a puzzle

1691: Unsolved De-novo Freestyle 154

Closed since almost 7 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary


Created
June 25, 2019
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:

GSREELLDRLDEILDEADKIIERANEALKEKDDKSKYQKLLKEHEEAVDKLLKIAEKHREMG

Top groups


  1. Avatar for HMT heritage 11. HMT heritage 1 pt. 9,731
  2. Avatar for Team China 12. Team China 1 pt. 9,192
  3. Avatar for BOINC@Poland 13. BOINC@Poland 1 pt. 9,124
  4. Avatar for Trinity Biology 14. Trinity Biology 1 pt. 8,789
  5. Avatar for DSN @ Home 15. DSN @ Home 1 pt. 0

  1. Avatar for Galaxie
    1. Galaxie Lv 1
    100 pts. 10,023
  2. Avatar for Deleted player 2. Deleted player pts. 10,007
  3. Avatar for Wilm 3. Wilm Lv 1 92 pts. 9,982
  4. Avatar for Bruno Kestemont 4. Bruno Kestemont Lv 1 89 pts. 9,977
  5. Avatar for actiasluna 5. actiasluna Lv 1 85 pts. 9,926
  6. Avatar for wisky 6. wisky Lv 1 81 pts. 9,891
  7. Avatar for robgee 7. robgee Lv 1 78 pts. 9,889
  8. Avatar for fiendish_ghoul 8. fiendish_ghoul Lv 1 75 pts. 9,872
  9. Avatar for crpainter 9. crpainter Lv 1 71 pts. 9,867
  10. Avatar for retiredmichael 10. retiredmichael Lv 1 68 pts. 9,863

Comments