Placeholder image of a protein
Icon representing a puzzle

1691: Unsolved De-novo Freestyle 154

Closed since almost 7 years ago

Intermediate Overall Prediction

Summary

Created
June 25, 2019
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:

GSREELLDRLDEILDEADKIIERANEALKEKDDKSKYQKLLKEHEEAVDKLLKIAEKHREMG

Top groups

  1. Avatar for HMT heritage 11. HMT heritage 1 pt. 9,731
  2. Avatar for Team China 12. Team China 1 pt. 9,192
  3. Avatar for BOINC@Poland 13. BOINC@Poland 1 pt. 9,124
  4. Avatar for Trinity Biology 14. Trinity Biology 1 pt. 8,789
  5. Avatar for DSN @ Home 15. DSN @ Home 1 pt. 0
  1. Avatar for tarimo 91. tarimo Lv 1 1 pt. 8,965
  2. Avatar for rabamino12358 92. rabamino12358 Lv 1 1 pt. 8,958
  3. Avatar for lconor 93. lconor Lv 1 1 pt. 8,904
  4. Avatar for kludbrook 94. kludbrook Lv 1 1 pt. 8,863
  5. Avatar for Datstandin 95. Datstandin Lv 1 1 pt. 8,837
  6. Avatar for alyssa_d 96. alyssa_d Lv 1 1 pt. 8,789
  7. Avatar for Forschender Doktorand 97. Forschender Doktorand Lv 1 1 pt. 8,652
  8. Avatar for IHGreenman 98. IHGreenman Lv 1 1 pt. 8,616
  9. Avatar for thesamster7 99. thesamster7 Lv 1 1 pt. 8,576
  10. Avatar for multaq 100. multaq Lv 1 1 pt. 8,570

Comments