Placeholder image of a protein
Icon representing a puzzle

1691: Unsolved De-novo Freestyle 154

Closed since almost 7 years ago

Intermediate Overall Prediction

Summary

Created
June 25, 2019
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:

GSREELLDRLDEILDEADKIIERANEALKEKDDKSKYQKLLKEHEEAVDKLLKIAEKHREMG

Top groups

  1. Avatar for HMT heritage 11. HMT heritage 1 pt. 9,731
  2. Avatar for Team China 12. Team China 1 pt. 9,192
  3. Avatar for BOINC@Poland 13. BOINC@Poland 1 pt. 9,124
  4. Avatar for Trinity Biology 14. Trinity Biology 1 pt. 8,789
  5. Avatar for DSN @ Home 15. DSN @ Home 1 pt. 0
  1. Avatar for abiogenesis 51. abiogenesis Lv 1 7 pts. 9,576
  2. Avatar for WBarme1234 52. WBarme1234 Lv 1 7 pts. 9,568
  3. Avatar for fpc 53. fpc Lv 1 6 pts. 9,551
  4. Avatar for navn 54. navn Lv 1 6 pts. 9,548
  5. Avatar for TastyMunchies 55. TastyMunchies Lv 1 6 pts. 9,524
  6. Avatar for benrh 56. benrh Lv 1 5 pts. 9,522
  7. Avatar for alwen 57. alwen Lv 1 5 pts. 9,517
  8. Avatar for hpaege 58. hpaege Lv 1 4 pts. 9,514
  9. Avatar for Artoria2e5 59. Artoria2e5 Lv 1 4 pts. 9,509
  10. Avatar for Hellcat6 60. Hellcat6 Lv 1 4 pts. 9,509

Comments