Placeholder image of a protein
Icon representing a puzzle

1691: Unsolved De-novo Freestyle 154

Closed since almost 7 years ago

Intermediate Overall Prediction

Summary

Created
June 25, 2019
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:

GSREELLDRLDEILDEADKIIERANEALKEKDDKSKYQKLLKEHEEAVDKLLKIAEKHREMG

Top groups

  1. Avatar for HMT heritage 11. HMT heritage 1 pt. 9,731
  2. Avatar for Team China 12. Team China 1 pt. 9,192
  3. Avatar for BOINC@Poland 13. BOINC@Poland 1 pt. 9,124
  4. Avatar for Trinity Biology 14. Trinity Biology 1 pt. 8,789
  5. Avatar for DSN @ Home 15. DSN @ Home 1 pt. 0
  1. Avatar for Silvercraft 61. Silvercraft Lv 1 4 pts. 9,466
  2. Avatar for harvardman 62. harvardman Lv 1 3 pts. 9,439
  3. Avatar for thewholeblahthing 63. thewholeblahthing Lv 1 3 pts. 9,437
  4. Avatar for PeterDav 64. PeterDav Lv 1 3 pts. 9,433
  5. Avatar for DoctorSockrates 65. DoctorSockrates Lv 1 3 pts. 9,412
  6. Avatar for Aminal88 66. Aminal88 Lv 1 3 pts. 9,399
  7. Avatar for Squirrely 67. Squirrely Lv 1 2 pts. 9,396
  8. Avatar for Blipperman 68. Blipperman Lv 1 2 pts. 9,361
  9. Avatar for Dantoto 69. Dantoto Lv 1 2 pts. 9,357
  10. Avatar for Deleted player 70. Deleted player pts. 9,348

Comments