Placeholder image of a protein
Icon representing a puzzle

1691: Unsolved De-novo Freestyle 154

Closed since almost 7 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary

Created
June 25, 2019
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:

GSREELLDRLDEILDEADKIIERANEALKEKDDKSKYQKLLKEHEEAVDKLLKIAEKHREMG

Top groups

  1. Avatar for HMT heritage 11. HMT heritage 1 pt. 9,731
  2. Avatar for Team China 12. Team China 1 pt. 9,192
  3. Avatar for BOINC@Poland 13. BOINC@Poland 1 pt. 9,124
  4. Avatar for Trinity Biology 14. Trinity Biology 1 pt. 8,789
  5. Avatar for DSN @ Home 15. DSN @ Home 1 pt. 0
  1. Avatar for helen88 81. helen88 Lv 1 1 pt. 9,192
  2. Avatar for boondog 82. boondog Lv 1 1 pt. 9,176
  3. Avatar for Tehnologik1 83. Tehnologik1 Lv 1 1 pt. 9,173
  4. Avatar for kentish_alex 84. kentish_alex Lv 1 1 pt. 9,167
  5. Avatar for rinze 85. rinze Lv 1 1 pt. 9,150
  6. Avatar for Pawel Tluscik 86. Pawel Tluscik Lv 1 1 pt. 9,139
  7. Avatar for kitek314_pl 87. kitek314_pl Lv 1 1 pt. 9,124
  8. Avatar for Arne Heessels 88. Arne Heessels Lv 1 1 pt. 9,117
  9. Avatar for mitarcher 89. mitarcher Lv 1 1 pt. 9,001
  10. Avatar for jausmh 90. jausmh Lv 1 1 pt. 8,971

Comments