Placeholder image of a protein
Icon representing a puzzle

1691: Unsolved De-novo Freestyle 154

Closed since over 6 years ago

Intermediate Overall Prediction

Summary


Created
June 25, 2019
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:

GSREELLDRLDEILDEADKIIERANEALKEKDDKSKYQKLLKEHEEAVDKLLKIAEKHREMG

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 10,023
  2. Avatar for Go Science 2. Go Science 70 pts. 9,985
  3. Avatar for Gargleblasters 3. Gargleblasters 47 pts. 9,928
  4. Avatar for Beta Folders 4. Beta Folders 30 pts. 9,878
  5. Avatar for Contenders 5. Contenders 19 pts. 9,867
  6. Avatar for Russian team 6. Russian team 11 pts. 9,856
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 7 pts. 9,849
  8. Avatar for Hold My Beer 8. Hold My Beer 4 pts. 9,824
  9. Avatar for Marvin's bunch 9. Marvin's bunch 2 pts. 9,756
  10. Avatar for Void Crushers 10. Void Crushers 1 pt. 9,736

  1. Avatar for silent gene 11. silent gene Lv 1 4 pts. 9,948
  2. Avatar for Skippysk8s 13. Skippysk8s Lv 1 2 pts. 9,928
  3. Avatar for ManVsYard 14. ManVsYard Lv 1 1 pt. 9,925
  4. Avatar for actiasluna 15. actiasluna Lv 1 1 pt. 9,903
  5. Avatar for Keresto 16. Keresto Lv 1 1 pt. 9,899
  6. Avatar for LociOiling 17. LociOiling Lv 1 1 pt. 9,878
  7. Avatar for Aminal88 18. Aminal88 Lv 1 1 pt. 9,824
  8. Avatar for jausmh 19. jausmh Lv 1 1 pt. 9,751
  9. Avatar for fpc 20. fpc Lv 1 1 pt. 9,730

Comments