Placeholder image of a protein
Icon representing a puzzle

1691: Unsolved De-novo Freestyle 154

Closed since almost 7 years ago

Intermediate Overall Prediction

Summary


Created
June 25, 2019
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:

GSREELLDRLDEILDEADKIIERANEALKEKDDKSKYQKLLKEHEEAVDKLLKIAEKHREMG

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 10,023
  2. Avatar for Go Science 2. Go Science 70 pts. 9,985
  3. Avatar for Gargleblasters 3. Gargleblasters 47 pts. 9,928
  4. Avatar for Beta Folders 4. Beta Folders 30 pts. 9,878
  5. Avatar for Contenders 5. Contenders 19 pts. 9,867
  6. Avatar for Russian team 6. Russian team 11 pts. 9,856
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 7 pts. 9,849
  8. Avatar for Hold My Beer 8. Hold My Beer 4 pts. 9,824
  9. Avatar for Marvin's bunch 9. Marvin's bunch 2 pts. 9,756
  10. Avatar for Void Crushers 10. Void Crushers 1 pt. 9,736

  1. Avatar for Mike Cassidy 31. Mike Cassidy Lv 1 24 pts. 9,736
  2. Avatar for O Seki To 32. O Seki To Lv 1 23 pts. 9,731
  3. Avatar for spvincent 33. spvincent Lv 1 22 pts. 9,726
  4. Avatar for anthion 34. anthion Lv 1 21 pts. 9,721
  5. Avatar for heather-1 35. heather-1 Lv 1 19 pts. 9,705
  6. Avatar for Skippysk8s 36. Skippysk8s Lv 1 18 pts. 9,704
  7. Avatar for RockOn 37. RockOn Lv 1 17 pts. 9,696
  8. Avatar for diamonddays 38. diamonddays Lv 1 16 pts. 9,692
  9. Avatar for joremen 39. joremen Lv 1 15 pts. 9,691
  10. Avatar for Museka 40. Museka Lv 1 15 pts. 9,685

Comments