Placeholder image of a protein
Icon representing a puzzle

1691: Unsolved De-novo Freestyle 154

Closed since almost 7 years ago

Intermediate Overall Prediction

Summary


Created
June 25, 2019
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:

GSREELLDRLDEILDEADKIIERANEALKEKDDKSKYQKLLKEHEEAVDKLLKIAEKHREMG

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 10,023
  2. Avatar for Go Science 2. Go Science 70 pts. 9,985
  3. Avatar for Gargleblasters 3. Gargleblasters 47 pts. 9,928
  4. Avatar for Beta Folders 4. Beta Folders 30 pts. 9,878
  5. Avatar for Contenders 5. Contenders 19 pts. 9,867
  6. Avatar for Russian team 6. Russian team 11 pts. 9,856
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 7 pts. 9,849
  8. Avatar for Hold My Beer 8. Hold My Beer 4 pts. 9,824
  9. Avatar for Marvin's bunch 9. Marvin's bunch 2 pts. 9,756
  10. Avatar for Void Crushers 10. Void Crushers 1 pt. 9,736

  1. Avatar for georg137 41. georg137 Lv 1 14 pts. 9,678
  2. Avatar for pvc78 42. pvc78 Lv 1 13 pts. 9,652
  3. Avatar for Merf 43. Merf Lv 1 12 pts. 9,643
  4. Avatar for Phyx 44. Phyx Lv 1 11 pts. 9,639
  5. Avatar for dizzywings 45. dizzywings Lv 1 11 pts. 9,629
  6. Avatar for stomjoh 46. stomjoh Lv 1 10 pts. 9,620
  7. Avatar for jobo0502 47. jobo0502 Lv 1 9 pts. 9,619
  8. Avatar for drumpeter18yrs9yrs 48. drumpeter18yrs9yrs Lv 1 9 pts. 9,618
  9. Avatar for toshiue 49. toshiue Lv 1 8 pts. 9,584
  10. Avatar for monteecristo 50. monteecristo Lv 1 8 pts. 9,578

Comments