Placeholder image of a protein
Icon representing a puzzle

1691: Unsolved De-novo Freestyle 154

Closed since almost 7 years ago

Intermediate Overall Prediction

Summary


Created
June 25, 2019
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:

GSREELLDRLDEILDEADKIIERANEALKEKDDKSKYQKLLKEHEEAVDKLLKIAEKHREMG

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 10,023
  2. Avatar for Go Science 2. Go Science 70 pts. 9,985
  3. Avatar for Gargleblasters 3. Gargleblasters 47 pts. 9,928
  4. Avatar for Beta Folders 4. Beta Folders 30 pts. 9,878
  5. Avatar for Contenders 5. Contenders 19 pts. 9,867
  6. Avatar for Russian team 6. Russian team 11 pts. 9,856
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 7 pts. 9,849
  8. Avatar for Hold My Beer 8. Hold My Beer 4 pts. 9,824
  9. Avatar for Marvin's bunch 9. Marvin's bunch 2 pts. 9,756
  10. Avatar for Void Crushers 10. Void Crushers 1 pt. 9,736

  1. Avatar for abiogenesis 51. abiogenesis Lv 1 7 pts. 9,576
  2. Avatar for WBarme1234 52. WBarme1234 Lv 1 7 pts. 9,568
  3. Avatar for fpc 53. fpc Lv 1 6 pts. 9,551
  4. Avatar for navn 54. navn Lv 1 6 pts. 9,548
  5. Avatar for TastyMunchies 55. TastyMunchies Lv 1 6 pts. 9,524
  6. Avatar for benrh 56. benrh Lv 1 5 pts. 9,522
  7. Avatar for alwen 57. alwen Lv 1 5 pts. 9,517
  8. Avatar for hpaege 58. hpaege Lv 1 4 pts. 9,514
  9. Avatar for Artoria2e5 59. Artoria2e5 Lv 1 4 pts. 9,509
  10. Avatar for Hellcat6 60. Hellcat6 Lv 1 4 pts. 9,509

Comments