Placeholder image of a protein
Icon representing a puzzle

1694: Unsolved De-novo Freestyle 154: Symmetric Dimer

Closed since over 6 years ago

Intermediate Overall Prediction Symmetry

Summary


Created
July 03, 2019
Expires
Max points
100
Description

This is a follow-up to Puzzle 1691: De-novo Freestyle 154, now with C2 symmetry. This protein was originally designed in the Baker Lab to bind to a different protein, but some lab results suggests the protein binds to itself as a dimer. In Puzzle 1691, we challenged the Foldit community to try and predict how the design might fold as a single, monomeric chain. Now we want to see if Foldit players can predict how the protein might fold and bind to itself with C2 symmetry. Players may load in solutions from Puzzle 1691. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:

GSREELLDRLDEILDEADKIIERANEALKEKDDKSKYQKLLKEHEEAVDKLLKIAEKHREMG

Top groups


  1. Avatar for Void Crushers 11. Void Crushers 1 pt. 12,453
  2. Avatar for BOINC@Poland 12. BOINC@Poland 1 pt. 12,328
  3. Avatar for Trinity Biology 13. Trinity Biology 1 pt. 11,707
  4. Avatar for DSN @ Home 14. DSN @ Home 1 pt. 2,876

  1. Avatar for lamoille 121. lamoille Lv 1 1 pt. 0
  2. Avatar for Michal93 122. Michal93 Lv 1 1 pt. 0

Comments