Placeholder image of a protein
Icon representing a puzzle

1694: Unsolved De-novo Freestyle 154: Symmetric Dimer

Closed since over 6 years ago

Intermediate Overall Prediction Symmetry

Summary


Created
July 03, 2019
Expires
Max points
100
Description

This is a follow-up to Puzzle 1691: De-novo Freestyle 154, now with C2 symmetry. This protein was originally designed in the Baker Lab to bind to a different protein, but some lab results suggests the protein binds to itself as a dimer. In Puzzle 1691, we challenged the Foldit community to try and predict how the design might fold as a single, monomeric chain. Now we want to see if Foldit players can predict how the protein might fold and bind to itself with C2 symmetry. Players may load in solutions from Puzzle 1691. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:

GSREELLDRLDEILDEADKIIERANEALKEKDDKSKYQKLLKEHEEAVDKLLKIAEKHREMG

Top groups


  1. Avatar for Void Crushers 11. Void Crushers 1 pt. 12,453
  2. Avatar for BOINC@Poland 12. BOINC@Poland 1 pt. 12,328
  3. Avatar for Trinity Biology 13. Trinity Biology 1 pt. 11,707
  4. Avatar for DSN @ Home 14. DSN @ Home 1 pt. 2,876

  1. Avatar for christioanchauvin 21. christioanchauvin Lv 1 41 pts. 13,028
  2. Avatar for nicobul 22. nicobul Lv 1 39 pts. 13,026
  3. Avatar for pvc78 23. pvc78 Lv 1 37 pts. 13,024
  4. Avatar for cbwest 24. cbwest Lv 1 35 pts. 13,023
  5. Avatar for Blipperman 25. Blipperman Lv 1 34 pts. 12,993
  6. Avatar for phi16 26. phi16 Lv 1 32 pts. 12,988
  7. Avatar for Museka 27. Museka Lv 1 30 pts. 12,967
  8. Avatar for guineapig 28. guineapig Lv 1 29 pts. 12,937
  9. Avatar for Merf 29. Merf Lv 1 27 pts. 12,936
  10. Avatar for Vinara 30. Vinara Lv 1 26 pts. 12,907

Comments