Placeholder image of a protein
Icon representing a puzzle

1694: Unsolved De-novo Freestyle 154: Symmetric Dimer

Closed since over 6 years ago

Intermediate Overall Prediction Symmetry

Summary


Created
July 03, 2019
Expires
Max points
100
Description

This is a follow-up to Puzzle 1691: De-novo Freestyle 154, now with C2 symmetry. This protein was originally designed in the Baker Lab to bind to a different protein, but some lab results suggests the protein binds to itself as a dimer. In Puzzle 1691, we challenged the Foldit community to try and predict how the design might fold as a single, monomeric chain. Now we want to see if Foldit players can predict how the protein might fold and bind to itself with C2 symmetry. Players may load in solutions from Puzzle 1691. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:

GSREELLDRLDEILDEADKIIERANEALKEKDDKSKYQKLLKEHEEAVDKLLKIAEKHREMG

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 13,764
  2. Avatar for Contenders 2. Contenders 68 pts. 13,728
  3. Avatar for Beta Folders 3. Beta Folders 44 pts. 13,700
  4. Avatar for Gargleblasters 4. Gargleblasters 27 pts. 13,478
  5. Avatar for Marvin's bunch 5. Marvin's bunch 16 pts. 13,455
  6. Avatar for Go Science 6. Go Science 9 pts. 13,429
  7. Avatar for Russian team 7. Russian team 5 pts. 13,101
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 3 pts. 13,028
  9. Avatar for HMT heritage 9. HMT heritage 1 pt. 12,902
  10. Avatar for Hold My Beer 10. Hold My Beer 1 pt. 12,593

  1. Avatar for Galaxie
    1. Galaxie Lv 1
    100 pts. 13,761
  2. Avatar for retiredmichael 2. retiredmichael Lv 1 96 pts. 13,669
  3. Avatar for Deleted player 3. Deleted player pts. 13,630
  4. Avatar for johnmitch 4. johnmitch Lv 1 89 pts. 13,485
  5. Avatar for actiasluna 5. actiasluna Lv 1 85 pts. 13,478
  6. Avatar for LociOiling 6. LociOiling Lv 1 81 pts. 13,416
  7. Avatar for grogar7 7. grogar7 Lv 1 78 pts. 13,391
  8. Avatar for frood66 8. frood66 Lv 1 75 pts. 13,357
  9. Avatar for Wilm 9. Wilm Lv 1 72 pts. 13,349
  10. Avatar for Bruno Kestemont 10. Bruno Kestemont Lv 1 68 pts. 13,324

Comments