Placeholder image of a protein
Icon representing a puzzle

1694: Unsolved De-novo Freestyle 154: Symmetric Dimer

Closed since almost 7 years ago

Intermediate Overall Prediction Symmetry

Summary


Created
July 03, 2019
Expires
Max points
100
Description

This is a follow-up to Puzzle 1691: De-novo Freestyle 154, now with C2 symmetry. This protein was originally designed in the Baker Lab to bind to a different protein, but some lab results suggests the protein binds to itself as a dimer. In Puzzle 1691, we challenged the Foldit community to try and predict how the design might fold as a single, monomeric chain. Now we want to see if Foldit players can predict how the protein might fold and bind to itself with C2 symmetry. Players may load in solutions from Puzzle 1691. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:

GSREELLDRLDEILDEADKIIERANEALKEKDDKSKYQKLLKEHEEAVDKLLKIAEKHREMG

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 13,764
  2. Avatar for Contenders 2. Contenders 68 pts. 13,728
  3. Avatar for Beta Folders 3. Beta Folders 44 pts. 13,700
  4. Avatar for Gargleblasters 4. Gargleblasters 27 pts. 13,478
  5. Avatar for Marvin's bunch 5. Marvin's bunch 16 pts. 13,455
  6. Avatar for Go Science 6. Go Science 9 pts. 13,429
  7. Avatar for Russian team 7. Russian team 5 pts. 13,101
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 3 pts. 13,028
  9. Avatar for HMT heritage 9. HMT heritage 1 pt. 12,902
  10. Avatar for Hold My Beer 10. Hold My Beer 1 pt. 12,593

  1. Avatar for felixxy 91. felixxy Lv 1 1 pt. 10,683
  2. Avatar for Arne Heessels 92. Arne Heessels Lv 1 1 pt. 10,667
  3. Avatar for kentish_alex 93. kentish_alex Lv 1 1 pt. 10,401
  4. Avatar for thesamster7 94. thesamster7 Lv 1 1 pt. 10,354
  5. Avatar for lconor 95. lconor Lv 1 1 pt. 10,273
  6. Avatar for NotJim99 96. NotJim99 Lv 1 1 pt. 10,237
  7. Avatar for Divisor11 97. Divisor11 Lv 1 1 pt. 10,218
  8. Avatar for ManVsYard 98. ManVsYard Lv 1 1 pt. 10,179
  9. Avatar for komnor 99. komnor Lv 1 1 pt. 10,143
  10. Avatar for Dantoto 100. Dantoto Lv 1 1 pt. 9,997

Comments