Placeholder image of a protein
Icon representing a puzzle

1694: Unsolved De-novo Freestyle 154: Symmetric Dimer

Closed since almost 7 years ago

Intermediate Overall Prediction Symmetry

Summary


Created
July 03, 2019
Expires
Max points
100
Description

This is a follow-up to Puzzle 1691: De-novo Freestyle 154, now with C2 symmetry. This protein was originally designed in the Baker Lab to bind to a different protein, but some lab results suggests the protein binds to itself as a dimer. In Puzzle 1691, we challenged the Foldit community to try and predict how the design might fold as a single, monomeric chain. Now we want to see if Foldit players can predict how the protein might fold and bind to itself with C2 symmetry. Players may load in solutions from Puzzle 1691. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:

GSREELLDRLDEILDEADKIIERANEALKEKDDKSKYQKLLKEHEEAVDKLLKIAEKHREMG

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 13,764
  2. Avatar for Contenders 2. Contenders 68 pts. 13,728
  3. Avatar for Beta Folders 3. Beta Folders 44 pts. 13,700
  4. Avatar for Gargleblasters 4. Gargleblasters 27 pts. 13,478
  5. Avatar for Marvin's bunch 5. Marvin's bunch 16 pts. 13,455
  6. Avatar for Go Science 6. Go Science 9 pts. 13,429
  7. Avatar for Russian team 7. Russian team 5 pts. 13,101
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 3 pts. 13,028
  9. Avatar for HMT heritage 9. HMT heritage 1 pt. 12,902
  10. Avatar for Hold My Beer 10. Hold My Beer 1 pt. 12,593

  1. Avatar for Gaouenn 111. Gaouenn Lv 1 1 pt. 5,863
  2. Avatar for rezaefar 112. rezaefar Lv 1 1 pt. 5,762
  3. Avatar for ScyllaHide 113. ScyllaHide Lv 1 1 pt. 4,476
  4. Avatar for Tomislaw 114. Tomislaw Lv 1 1 pt. 4,153
  5. Avatar for itisyuuu 115. itisyuuu Lv 1 1 pt. 3,471
  6. Avatar for aspadistra 116. aspadistra Lv 1 1 pt. 2,876
  7. Avatar for 01010011111 117. 01010011111 Lv 1 1 pt. 0
  8. Avatar for jeff101 119. jeff101 Lv 1 1 pt. 0
  9. Avatar for andrewxc 120. andrewxc Lv 1 1 pt. 0

Comments