Placeholder image of a protein
Icon representing a puzzle

1696: Revisiting Puzzle 59: TCR Binding Protein

Closed since over 6 years ago

Novice Overall Prediction

Summary

Created
July 08, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small, intracellular domain binds to the CD2 T cell receptor (TCR), and plays a critical role in T cell activation during the immune response. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


DVMWEYKWENTGDAELYGPFTSAQMQTWVSEGYFPDGVYCRKLDPPGGQFYNSKRIDFDLYT

Top groups

  1. Avatar for The Daydreamers 11. The Daydreamers 1 pt. 9,456
  2. Avatar for Trinity Biology 12. Trinity Biology 1 pt. 9,418
  3. Avatar for BOINC@Poland 13. BOINC@Poland 1 pt. 9,036
  4. Avatar for DSN @ Home 14. DSN @ Home 1 pt. 9,035
  5. Avatar for FoldIt@Netherlands 15. FoldIt@Netherlands 1 pt. 8,953
  6. Avatar for Proteinchemie 16. Proteinchemie 1 pt. 3,611
  1. Avatar for grogar7
    1. grogar7 Lv 1
    100 pts. 10,137
  2. Avatar for nicobul 2. nicobul Lv 1 96 pts. 10,100
  3. Avatar for Bruno Kestemont 3. Bruno Kestemont Lv 1 92 pts. 10,086
  4. Avatar for O Seki To 4. O Seki To Lv 1 88 pts. 10,085
  5. Avatar for LociOiling 5. LociOiling Lv 1 84 pts. 10,085
  6. Avatar for Phyx 6. Phyx Lv 1 81 pts. 10,067
  7. Avatar for retiredmichael 7. retiredmichael Lv 1 77 pts. 10,062
  8. Avatar for tyler0911 8. tyler0911 Lv 1 74 pts. 10,053
  9. Avatar for crpainter 9. crpainter Lv 1 70 pts. 10,045
  10. Avatar for dcrwheeler 10. dcrwheeler Lv 1 67 pts. 10,043

Comments