Placeholder image of a protein
Icon representing a puzzle

1696: Revisiting Puzzle 59: TCR Binding Protein

Closed since almost 7 years ago

Novice Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
July 08, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small, intracellular domain binds to the CD2 T cell receptor (TCR), and plays a critical role in T cell activation during the immune response. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


DVMWEYKWENTGDAELYGPFTSAQMQTWVSEGYFPDGVYCRKLDPPGGQFYNSKRIDFDLYT

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 10,137
  2. Avatar for L'Alliance Francophone 2. L'Alliance Francophone 71 pts. 10,100
  3. Avatar for Go Science 3. Go Science 49 pts. 10,088
  4. Avatar for Gargleblasters 4. Gargleblasters 33 pts. 10,086
  5. Avatar for HMT heritage 5. HMT heritage 22 pts. 10,085
  6. Avatar for Beta Folders 6. Beta Folders 14 pts. 10,085
  7. Avatar for Marvin's bunch 7. Marvin's bunch 8 pts. 10,047
  8. Avatar for Contenders 8. Contenders 5 pts. 10,045
  9. Avatar for Russian team 9. Russian team 3 pts. 10,037
  10. Avatar for Hold My Beer 10. Hold My Beer 2 pts. 9,457

  1. Avatar for Galaxie
    1. Galaxie Lv 1
    100 pts. 10,117
  2. Avatar for phi16 2. phi16 Lv 1 79 pts. 10,107
  3. Avatar for Museka 3. Museka Lv 1 61 pts. 10,092
  4. Avatar for Alistair69 4. Alistair69 Lv 1 47 pts. 10,092
  5. Avatar for Bruno Kestemont 5. Bruno Kestemont Lv 1 35 pts. 10,088
  6. Avatar for toshiue 6. toshiue Lv 1 26 pts. 10,087
  7. Avatar for ManVsYard 7. ManVsYard Lv 1 19 pts. 10,086
  8. Avatar for actiasluna 8. actiasluna Lv 1 14 pts. 10,085
  9. Avatar for silent gene 9. silent gene Lv 1 10 pts. 10,085
  10. Avatar for LociOiling 10. LociOiling Lv 1 7 pts. 10,085

Comments