Placeholder image of a protein
Icon representing a puzzle

1697: Unsolved De-novo Freestyle 155

Closed since over 6 years ago

Intermediate Overall Prediction

Summary

Created
July 10, 2019
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:

PESALRRYVALRMMLYLMRKGGLRPNEVREVRNKVKKIWEDRDEGKLTPEGFTEKLEQILRELVKKVRERQEKKK

Top groups

  1. Avatar for Void Crushers 11. Void Crushers 1 pt. 9,827
  2. Avatar for The Daydreamers 12. The Daydreamers 1 pt. 9,570
  3. Avatar for Trinity Biology 13. Trinity Biology 1 pt. 9,334
  4. Avatar for BOINC@Poland 14. BOINC@Poland 1 pt. 9,292
  5. Avatar for FoldIt@Netherlands 15. FoldIt@Netherlands 1 pt. 8,974
  6. Avatar for DSN @ Home 16. DSN @ Home 1 pt. 0
  1. Avatar for guineapig
    1. guineapig Lv 1
    100 pts. 10,292
  2. Avatar for Galaxie 2. Galaxie Lv 1 96 pts. 10,259
  3. Avatar for Bruno Kestemont 3. Bruno Kestemont Lv 1 92 pts. 10,254
  4. Avatar for vakobo 4. vakobo Lv 1 88 pts. 10,222
  5. Avatar for christioanchauvin 5. christioanchauvin Lv 1 84 pts. 10,208
  6. Avatar for Blipperman 6. Blipperman Lv 1 80 pts. 10,136
  7. Avatar for grogar7 7. grogar7 Lv 1 77 pts. 10,132
  8. Avatar for dcrwheeler 8. dcrwheeler Lv 1 73 pts. 10,120
  9. Avatar for fiendish_ghoul 9. fiendish_ghoul Lv 1 70 pts. 10,118
  10. Avatar for gurch 10. gurch Lv 1 67 pts. 10,112

Comments