Placeholder image of a protein
Icon representing a puzzle

1697: Unsolved De-novo Freestyle 155

Closed since over 6 years ago

Intermediate Overall Prediction

Summary

Created
July 10, 2019
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:

PESALRRYVALRMMLYLMRKGGLRPNEVREVRNKVKKIWEDRDEGKLTPEGFTEKLEQILRELVKKVRERQEKKK

Top groups

  1. Avatar for Void Crushers 11. Void Crushers 1 pt. 9,827
  2. Avatar for The Daydreamers 12. The Daydreamers 1 pt. 9,570
  3. Avatar for Trinity Biology 13. Trinity Biology 1 pt. 9,334
  4. Avatar for BOINC@Poland 14. BOINC@Poland 1 pt. 9,292
  5. Avatar for FoldIt@Netherlands 15. FoldIt@Netherlands 1 pt. 8,974
  6. Avatar for DSN @ Home 16. DSN @ Home 1 pt. 0
  1. Avatar for Galaxie
    1. Galaxie Lv 1
    100 pts. 10,259
  2. Avatar for toshiue 2. toshiue Lv 1 83 pts. 10,254
  3. Avatar for Bruno Kestemont 3. Bruno Kestemont Lv 1 68 pts. 10,254
  4. Avatar for silent gene 4. silent gene Lv 1 55 pts. 10,252
  5. Avatar for Anfinsen_slept_here 5. Anfinsen_slept_here Lv 1 44 pts. 10,251
  6. Avatar for robgee 6. robgee Lv 1 35 pts. 10,246
  7. Avatar for phi16 7. phi16 Lv 1 27 pts. 10,246
  8. Avatar for Deleted player 8. Deleted player pts. 10,245
  9. Avatar for alcor29 9. alcor29 Lv 1 16 pts. 10,220
  10. Avatar for lamoille 10. lamoille Lv 1 12 pts. 10,200

Comments