Placeholder image of a protein
Icon representing a puzzle

1697: Unsolved De-novo Freestyle 155

Closed since almost 7 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
July 10, 2019
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:

PESALRRYVALRMMLYLMRKGGLRPNEVREVRNKVKKIWEDRDEGKLTPEGFTEKLEQILRELVKKVRERQEKKK

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 10,259
  2. Avatar for Go Science 2. Go Science 71 pts. 10,254
  3. Avatar for Russian team 3. Russian team 49 pts. 10,222
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 33 pts. 10,208
  5. Avatar for Gargleblasters 5. Gargleblasters 22 pts. 10,165
  6. Avatar for Contenders 6. Contenders 14 pts. 10,153
  7. Avatar for Beta Folders 7. Beta Folders 8 pts. 10,124
  8. Avatar for Marvin's bunch 8. Marvin's bunch 5 pts. 10,029
  9. Avatar for Hold My Beer 9. Hold My Beer 3 pts. 9,953
  10. Avatar for HMT heritage 10. HMT heritage 2 pts. 9,917

  1. Avatar for Galaxie
    1. Galaxie Lv 1
    100 pts. 10,259
  2. Avatar for toshiue 2. toshiue Lv 1 83 pts. 10,254
  3. Avatar for Bruno Kestemont 3. Bruno Kestemont Lv 1 68 pts. 10,254
  4. Avatar for silent gene 4. silent gene Lv 1 55 pts. 10,252
  5. Avatar for Anfinsen_slept_here 5. Anfinsen_slept_here Lv 1 44 pts. 10,251
  6. Avatar for robgee 6. robgee Lv 1 35 pts. 10,246
  7. Avatar for phi16 7. phi16 Lv 1 27 pts. 10,246
  8. Avatar for Deleted player 8. Deleted player pts. 10,245
  9. Avatar for alcor29 9. alcor29 Lv 1 16 pts. 10,220
  10. Avatar for lamoille 10. lamoille Lv 1 12 pts. 10,200

Comments