Placeholder image of a protein
Icon representing a puzzle

1697: Unsolved De-novo Freestyle 155

Closed since over 6 years ago

Intermediate Overall Prediction

Summary

Created
July 10, 2019
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:

PESALRRYVALRMMLYLMRKGGLRPNEVREVRNKVKKIWEDRDEGKLTPEGFTEKLEQILRELVKKVRERQEKKK

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 10,259
  2. Avatar for Go Science 2. Go Science 71 pts. 10,254
  3. Avatar for Russian team 3. Russian team 49 pts. 10,222
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 33 pts. 10,208
  5. Avatar for Gargleblasters 5. Gargleblasters 22 pts. 10,165
  6. Avatar for Contenders 6. Contenders 14 pts. 10,153
  7. Avatar for Beta Folders 7. Beta Folders 8 pts. 10,124
  8. Avatar for Marvin's bunch 8. Marvin's bunch 5 pts. 10,029
  9. Avatar for Hold My Beer 9. Hold My Beer 3 pts. 9,953
  10. Avatar for HMT heritage 10. HMT heritage 2 pts. 9,917
  1. Avatar for actiasluna 11. actiasluna Lv 1 9 pts. 10,165
  2. Avatar for Keresto 12. Keresto Lv 1 7 pts. 10,163
  3. Avatar for Skippysk8s 13. Skippysk8s Lv 1 5 pts. 10,162
  4. Avatar for georg137 14. georg137 Lv 1 4 pts. 10,153
  5. Avatar for ManVsYard 15. ManVsYard Lv 1 3 pts. 10,141
  6. Avatar for LociOiling 16. LociOiling Lv 1 2 pts. 10,124
  7. Avatar for Phyx 17. Phyx Lv 1 1 pt. 10,033
  8. Avatar for Dhalion 18. Dhalion Lv 1 1 pt. 10,030
  9. Avatar for fpc 19. fpc Lv 1 1 pt. 10,029
  10. Avatar for Blipperman 20. Blipperman Lv 1 1 pt. 9,966

Comments