Placeholder image of a protein
Icon representing a puzzle

1702: Revisiting Puzzle 61: Designer Protein Top7

Closed since over 6 years ago

Novice Overall Prediction

Summary

Created
July 22, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein was designed by the Baker Lab in 2003, and has a topology unlike any natural protein yet discovered. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


DIQVQVNIDDNGKNFDYTYTVTTESELQKVLNELMDYIKKQGAKRVRISITARTKKEAEKFAAILIKVFAELGYNDINVTFDGDTVTVEGQL

Top groups

  1. Avatar for Trinity Biology 11. Trinity Biology 1 pt. 10,346
  2. Avatar for Team South Africa 12. Team South Africa 1 pt. 10,320
  3. Avatar for FoldIt@Netherlands 13. FoldIt@Netherlands 1 pt. 10,182
  4. Avatar for Void Crushers 14. Void Crushers 1 pt. 9,964
  5. Avatar for BOINC@Poland 15. BOINC@Poland 1 pt. 9,470
  1. Avatar for johnmitch
    1. johnmitch Lv 1
    100 pts. 11,734
  2. Avatar for actiasluna 2. actiasluna Lv 1 96 pts. 11,732
  3. Avatar for Bruno Kestemont 3. Bruno Kestemont Lv 1 92 pts. 11,732
  4. Avatar for retiredmichael 4. retiredmichael Lv 1 88 pts. 11,727
  5. Avatar for LociOiling 5. LociOiling Lv 1 85 pts. 11,695
  6. Avatar for Galaxie 6. Galaxie Lv 1 81 pts. 11,669
  7. Avatar for diamonddays 7. diamonddays Lv 1 78 pts. 11,636
  8. Avatar for NinjaGreg 8. NinjaGreg Lv 1 74 pts. 11,610
  9. Avatar for robgee 9. robgee Lv 1 71 pts. 11,601
  10. Avatar for Phyx 10. Phyx Lv 1 68 pts. 11,597

Comments