Placeholder image of a protein
Icon representing a puzzle

1702: Revisiting Puzzle 61: Designer Protein Top7

Closed since over 6 years ago

Novice Overall Prediction

Summary

Created
July 22, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein was designed by the Baker Lab in 2003, and has a topology unlike any natural protein yet discovered. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


DIQVQVNIDDNGKNFDYTYTVTTESELQKVLNELMDYIKKQGAKRVRISITARTKKEAEKFAAILIKVFAELGYNDINVTFDGDTVTVEGQL

Top groups

  1. Avatar for Trinity Biology 11. Trinity Biology 1 pt. 10,346
  2. Avatar for Team South Africa 12. Team South Africa 1 pt. 10,320
  3. Avatar for FoldIt@Netherlands 13. FoldIt@Netherlands 1 pt. 10,182
  4. Avatar for Void Crushers 14. Void Crushers 1 pt. 9,964
  5. Avatar for BOINC@Poland 15. BOINC@Poland 1 pt. 9,470
  1. Avatar for ManVsYard
    1. ManVsYard Lv 1
    100 pts. 11,749
  2. Avatar for actiasluna 2. actiasluna Lv 1 76 pts. 11,749
  3. Avatar for Keresto 3. Keresto Lv 1 56 pts. 11,733
  4. Avatar for Blipperman 4. Blipperman Lv 1 41 pts. 11,732
  5. Avatar for Bruno Kestemont 5. Bruno Kestemont Lv 1 29 pts. 11,731
  6. Avatar for LociOiling 6. LociOiling Lv 1 20 pts. 11,729
  7. Avatar for toshiue 7. toshiue Lv 1 14 pts. 11,728
  8. Avatar for smilingone 8. smilingone Lv 1 9 pts. 11,724
  9. Avatar for silent gene 9. silent gene Lv 1 6 pts. 11,702
  10. Avatar for Willyanto 10. Willyanto Lv 1 4 pts. 11,688

Comments