Placeholder image of a protein
Icon representing a puzzle

1702: Revisiting Puzzle 61: Designer Protein Top7

Closed since over 6 years ago

Novice Overall Prediction

Summary

Created
July 22, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein was designed by the Baker Lab in 2003, and has a topology unlike any natural protein yet discovered. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


DIQVQVNIDDNGKNFDYTYTVTTESELQKVLNELMDYIKKQGAKRVRISITARTKKEAEKFAAILIKVFAELGYNDINVTFDGDTVTVEGQL

Top groups

  1. Avatar for Gargleblasters
    1. Gargleblasters
    100 pts. 11,749
  2. Avatar for Go Science 2. Go Science 70 pts. 11,732
  3. Avatar for Beta Folders 3. Beta Folders 47 pts. 11,729
  4. Avatar for Marvin's bunch 4. Marvin's bunch 30 pts. 11,685
  5. Avatar for Anthropic Dreams 5. Anthropic Dreams 19 pts. 11,670
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 11 pts. 11,572
  7. Avatar for HMT heritage 7. HMT heritage 7 pts. 11,489
  8. Avatar for Hold My Beer 8. Hold My Beer 4 pts. 11,472
  9. Avatar for Russian team 9. Russian team 2 pts. 11,441
  10. Avatar for Contenders 10. Contenders 1 pt. 11,417
  1. Avatar for ManVsYard
    1. ManVsYard Lv 1
    100 pts. 11,749
  2. Avatar for actiasluna 2. actiasluna Lv 1 76 pts. 11,749
  3. Avatar for Keresto 3. Keresto Lv 1 56 pts. 11,733
  4. Avatar for Blipperman 4. Blipperman Lv 1 41 pts. 11,732
  5. Avatar for Bruno Kestemont 5. Bruno Kestemont Lv 1 29 pts. 11,731
  6. Avatar for LociOiling 6. LociOiling Lv 1 20 pts. 11,729
  7. Avatar for toshiue 7. toshiue Lv 1 14 pts. 11,728
  8. Avatar for smilingone 8. smilingone Lv 1 9 pts. 11,724
  9. Avatar for silent gene 9. silent gene Lv 1 6 pts. 11,702
  10. Avatar for Willyanto 10. Willyanto Lv 1 4 pts. 11,688

Comments