Placeholder image of a protein
Icon representing a puzzle

1709: Revisiting Puzzle 63: Spinach Protein

Closed since over 6 years ago

Novice Overall Prediction

Summary


Created
August 05, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This spinach protein is critical for photosynthesis, and participates in the electron transfer chain within the chloroplast. The protein is modeled here in the reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AAYKVTLVTPTGNVEFQCPDDVYILDAAEEEGIDLPYSCRAGSCSSCAGKLKTGSLNQDDQSFLDDDQIDEGWVLTCAAYPVSDVTIETHKKEELTA

Top groups


  1. Avatar for BOINC@Poland 11. BOINC@Poland 1 pt. 10,808
  2. Avatar for Italiani Al Lavoro 12. Italiani Al Lavoro 1 pt. 10,301
  3. Avatar for Trinity Biology 13. Trinity Biology 1 pt. 10,020
  4. Avatar for Rechenkraft.net 14. Rechenkraft.net 1 pt. 9,970
  5. Avatar for xkcd 15. xkcd 1 pt. 9,687
  6. Avatar for The Daydreamers 16. The Daydreamers 1 pt. 8,602
  7. Avatar for Macromolecules@MQ 2019 17. Macromolecules@MQ 2019 1 pt. 2,572

  1. Avatar for minhhungtuan 91. minhhungtuan Lv 1 1 pt. 6,821
  2. Avatar for kevin everington 92. kevin everington Lv 1 1 pt. 6,801
  3. Avatar for SLYHPM 93. SLYHPM Lv 1 1 pt. 6,718
  4. Avatar for The_NOOB 94. The_NOOB Lv 1 1 pt. 6,700
  5. Avatar for GUANINJIN 95. GUANINJIN Lv 1 1 pt. 6,641
  6. Avatar for Alicates 96. Alicates Lv 1 1 pt. 6,575
  7. Avatar for Sydefecks 97. Sydefecks Lv 1 1 pt. 6,420
  8. Avatar for Anamfija 98. Anamfija Lv 1 1 pt. 6,381
  9. Avatar for Deleted player 99. Deleted player 1 pt. 6,375
  10. Avatar for DipsyDoodle2016 100. DipsyDoodle2016 Lv 1 1 pt. 6,305

Comments