Placeholder image of a protein
Icon representing a puzzle

1709: Revisiting Puzzle 63: Spinach Protein

Closed since over 6 years ago

Novice Overall Prediction

Summary

Created
August 05, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This spinach protein is critical for photosynthesis, and participates in the electron transfer chain within the chloroplast. The protein is modeled here in the reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AAYKVTLVTPTGNVEFQCPDDVYILDAAEEEGIDLPYSCRAGSCSSCAGKLKTGSLNQDDQSFLDDDQIDEGWVLTCAAYPVSDVTIETHKKEELTA

Top groups

  1. Avatar for BOINC@Poland 11. BOINC@Poland 1 pt. 10,808
  2. Avatar for Italiani Al Lavoro 12. Italiani Al Lavoro 1 pt. 10,301
  3. Avatar for Trinity Biology 13. Trinity Biology 1 pt. 10,020
  4. Avatar for Rechenkraft.net 14. Rechenkraft.net 1 pt. 9,970
  5. Avatar for xkcd 15. xkcd 1 pt. 9,687
  6. Avatar for The Daydreamers 16. The Daydreamers 1 pt. 8,602
  7. Avatar for Macromolecules@MQ 2019 17. Macromolecules@MQ 2019 1 pt. 2,572
  1. Avatar for Erenpal 111. Erenpal Lv 1 1 pt. 4,646
  2. Avatar for harvardman 112. harvardman Lv 1 1 pt. 4,595
  3. Avatar for s117671 113. s117671 Lv 1 1 pt. 4,456
  4. Avatar for dr_ljbrown 114. dr_ljbrown Lv 1 1 pt. 2,572
  5. Avatar for 01010011111 115. 01010011111 Lv 1 1 pt. 2,276
  6. Avatar for Paulo Roque 116. Paulo Roque Lv 1 1 pt. 0
  7. Avatar for Bletchley Park 117. Bletchley Park Lv 1 1 pt. 0
  8. Avatar for ManVsYard 118. ManVsYard Lv 1 1 pt. 0

Comments