Placeholder image of a protein
Icon representing a puzzle

1709: Revisiting Puzzle 63: Spinach Protein

Closed since over 6 years ago

Novice Overall Prediction

Summary

Created
August 05, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This spinach protein is critical for photosynthesis, and participates in the electron transfer chain within the chloroplast. The protein is modeled here in the reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AAYKVTLVTPTGNVEFQCPDDVYILDAAEEEGIDLPYSCRAGSCSSCAGKLKTGSLNQDDQSFLDDDQIDEGWVLTCAAYPVSDVTIETHKKEELTA

Top groups

  1. Avatar for BOINC@Poland 11. BOINC@Poland 1 pt. 10,808
  2. Avatar for Italiani Al Lavoro 12. Italiani Al Lavoro 1 pt. 10,301
  3. Avatar for Trinity Biology 13. Trinity Biology 1 pt. 10,020
  4. Avatar for Rechenkraft.net 14. Rechenkraft.net 1 pt. 9,970
  5. Avatar for xkcd 15. xkcd 1 pt. 9,687
  6. Avatar for The Daydreamers 16. The Daydreamers 1 pt. 8,602
  7. Avatar for Macromolecules@MQ 2019 17. Macromolecules@MQ 2019 1 pt. 2,572
  1. Avatar for johngran 41. johngran Lv 1 13 pts. 10,570
  2. Avatar for dcrwheeler 42. dcrwheeler Lv 1 12 pts. 10,555
  3. Avatar for jamiexq 43. jamiexq Lv 1 11 pts. 10,543
  4. Avatar for Hellcat6 44. Hellcat6 Lv 1 11 pts. 10,532
  5. Avatar for cobaltteal 45. cobaltteal Lv 1 10 pts. 10,489
  6. Avatar for cbwest 46. cbwest Lv 1 9 pts. 10,479
  7. Avatar for stomjoh 47. stomjoh Lv 1 9 pts. 10,475
  8. Avatar for alcor29 48. alcor29 Lv 1 8 pts. 10,434
  9. Avatar for rezaefar 49. rezaefar Lv 1 8 pts. 10,430
  10. Avatar for Mrubiquitin 50. Mrubiquitin Lv 1 7 pts. 10,429

Comments